www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Oxyntomodulin

Oxyntomodulin

Quick view: Suppliers
BGC Id:
301994806582
CAS No.:
Synonyms:
hsqgtftsdyskyldsrraqdfvqwlmntkrnknnia | oxyntomodulin (porcine) | glucagon 37 | oxyntomodulin | enteroglucagon | m.w. 4421.86 c192h295n59o60s | enteroglucagon | glucagon (1-37) (porcine) | h-his-ser-gln-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-gln-asp-phe-val-gln-trp-leu-met-asn-thr-lys-arg-asn-lys-asn-asn-ile-ala-oh | glucagon 1-37
Formula:
C192H295N59O60S

List of Suppliers

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. Ethyl 2-bromo-2,2-difluoroacetate is also served by BuGuCh & Partners. BuGuCh & Partners is supplier for Oxyntomodulin. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Most viewed

Within the past time user are also interested in the following chemicals.
DL-alpha-Phosphatidylcholine dipalmitoyl
Structure

Suppliers and manufactures - with identical CAS number as Oxyntomodulin

For the following products supplier are listed below:
    Glucagon (1-37) (porcine)
    Oxyntomodulin (porcine, bovine)


Supplier of

Glucagon (1-37) (porcine)

(CAS: 62340-29-8)

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. We are seller of (3S)-4-Acetyl-1,3-dihydro-1-oxo-5-[(1S)-1,3,3-trimethylcyclohexyl]isobenzofuran-3-ol acetate. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Supplier of

Oxyntomodulin (porcine, bovine)

(CAS: 62340-29-8)

polypeptide.ltd

Company type: Laboratory supplier
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the Fine Chemical Industrial Park of Zhangpan Town, Xuchang, Henan Province, with 10 million square meters, total assets of 10 million US dollars, and more than 100 employees. Shangke Chemical is a high-tech enterprise specializing in active pharmaceutical intermediates (APIs). Glepaglutide is also served by polypeptide.ltd. To control the quality during production, a large number of experienced professionals, a first-class pr ...
Country: P.R.China   Phone: +86 152 1950 7320   Telefax:


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


FUDI Chemical Co. Ltd.
FUDI is an international chemical distributor.If you can't find it in our bulk catalog, we are


Xi´an SR Bio-Engineerin
Xi'an SR Bio-Engineering Co., Ltd established in 2009, is an expert in the field of biochemistry, p


Allfluoro Pharmaceutica
Founded in 2015, Allfluoro pharmaceutical co. ltd. (AFPA) is a privately held, organic fluorine com


Henan Sinowin Che
Henan Sinowin Chemical Industry Co.,Ltd. is established in 2003, it's located in Zhengzhou industri


Wuhan Biet Co., Ltd.
WUHAN BIET CO.,LTD was set up in July 2010.It specializes in theproduction,research,development and


ZHIWE ChemTech Co Ltd
Zhi. is a leading company established in 2009, focusing on Active Pharmaceutical Ingredients (API)


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Oxyntomodulin