www.BuyersGuideChem.com - directory for chemicals and chemical suppliers
Productname:

BGC > Chemicals A-Z > Sermorelin

Sermorelin

Structure
Quick view: Suppliers
BGC Id:
391844204445
CAS No.:
Synonyms:
somatoliberin fragment 1-29 amide, human | growth hormone releasing factor*fragment 1-29 ami | yadaiftnsyrkvlgqlsarkllqdimsr-nh2 | sermorelin acetate | grf (1-29) amide (human) sermorelin | ghrf (1-29), amide, human | sermorelin | sermorelin aceta | grf (1-29) amide (human) | green tea powdered extract
Formula:
C149H246N44O42S
Molecular Weight:
3357.88

Suppliers & Distributors

image supplier ww
registered suppliers of Sermorelin worldwide
Listed are 12 international and reliable suppliers for Sermorelin. They are coming from 2 countries around the world. These vendors belong to 5 different business types like 'Analytical Institution' and 'Leading producer'
Please contact all the below listed distributors/manufacturers for Sermorelin and ask for prices, package standards and transport possibilities. Our registered distributors will help you to get all necessary information and product specifications.




List of Suppliers

Shandong Ench Chemical Co.,Ltd

Company type: Producer
Shandong Ench Chemical Co.Ltd is a professional manufacturers and supplier in the world ,the main product include chemical pharmaceuticals and intermediates, food and feed additives, herbal extracts, agrochemicals and fine chemicals etc. It is a privet-owned enterprise and located in Zhangqiu industrial park, We believe that quality is the life of our company. Shandong Ench Chemical Co.,Ltd is supplier for Sermorelin. We are seller of . We manufacture our products in strict accordance with ISO9001: 2000 quality management system during the whole en ...
Country: P.R.China   Phone: +86-13869131854   Telefax: +86 531-8637666

AASraw

Company type: Bulk chemical producer
AASraw aims to be the most trusted CDMO of API in the world! AASraw is the professional manufacturer which has independent lab and large factory as support, all production will be carried out under CGMP regulation and trackable quality control system. AASraw is a seller of . AASraw is supplier for Sermorelin. The supply system is stable, both retail and wholesale orders are acceptable.Welcome to order from AASraw!
Country: P.R.China   Phone: +86 18824303959   Telefax:

polypeptide.ltd

Company type: Laboratory supplier
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the Fine Chemical Industrial Park of Zhangpan Town, Xuchang, Henan Province, with 10 million square meters, total assets of 10 million US dollars, and more than 100 employees. Shangke Chemical is a high-tech enterprise specializing in active pharmaceutical intermediates (APIs). polypeptide.ltd is supplier for Sermorelin. polypeptide.ltd is a seller of Degarelix acetate. To control the quality during production, a large number of experienced professionals, a first-class pr ...
Country: P.R.China   Phone: +86 152 1950 7320   Telefax:

Arcadia Biotechnology

Company type: Analytical Institution
We are the leading company in China, to supply nutrtional supplements ingredients, APIs and it's intermediates. We supply our chemical product Boc-3-(4-Biphenylyl)-D-alanine. We also provide finished product and consulting service. Arcadia Biotechnology is supplier for Sermorelin.
Country: P.R.China   Phone: +86 21 61353236   Telefax: +86 21 61353239

Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical)

Company type: Producer
Conscientia Industrial Co., Ltd (Conscientia Pharm) mainly engages in developing, manufacturing, marketing, APIs (Active Pharmaceutical Ingredients), pharmaceutical intermediates. Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical) is supplier for Sermorelin. Conscientia Industrial Co., Ltd (Zhejiang Conscientia Pharmaceutical) also offers L-Thioproline. Besides, we provide services of custom synthesis and contract manufacturing APIs (Active Pharmaceutical Ingredients), intermediates, fine chemicals for generic and new drugs. Conscientia Industrial aims to be world-class pharmaceutical raw materials supplier through unflagging efforts in quality, i ...
Country: P.R.China   Phone: +86 170 9858 0209   Telefax: +86 170 9858 0209

Alpha Biopharmaceuticals Co., Ltd.

Company type: Producer
Alabiochem company locates at a beautiful chinese city-SuZhou. We are a professional biochemical company engaged in researching, developing, manufacturing pharmaceutical peptide、new amino acid, peptide synthetic technique and new type of peptide. Moreover, we are focused on nucleic acid and other small organic compounds. We are supplier of Boc-D-Dap(ivDde)-OH. Alabiochem company not only provides contact research but custom synthesis service. Alpha Biopharmaceuticals Co., Ltd. is supplier for Sermorelin.
Country: P.R.China   Phone: +86-411-39042497   Telefax: +86-411-39042693

Hangzhou Zhongqi Chem Co., Ltd

Company type: Leading producer
Located in Hangzhou National Hi-Tech Industrial Development Zone, zhongqichem is a technical company mainly focus on the Custom synthesis, manufacturing, sales of chemicals to various industries. Hangzhou Zhongqi Chem Co., Ltd is supplier for Sermorelin. We provide Trimethoxymethane as well. Our advantage : 1.We do not simply provide chemicals , we provide chemical solutions and expertise; 2.We have trained, highly effective team to solve the problem at the first time; 3.Our QMS (quality management system) ensures the product quality strictly; 4.Stro ...
Country: P.R.China   Phone: +86-571-86976032   Telefax: +86-571-86972162

Hangzhou Keying Chem Co., Ltd.

Company type: Analytical Institution
Hangzhou Keying Chem Co., Ltd. Is a comprehensive enterprise, dedicated to the development, production and marketing of chemicals. As a technology innovative and service professional enterprise, Our company mainly engages in global pharmaceutical, chemical and biological service. After years of development, our company has accumulated abundant products resources in local China and international market which increasingly satisfy development requirements of customers. Hangzhou Keying Chem Co., Ltd. is a seller of 2,5-Dimethoxybenzaldehyde. Hangzhou Keying Chem Co., Ltd. is supplier for Sermorelin. The p ...
Country: P.R.China   Phone: +86-571-85378921   Telefax: +86-571-85378913

Skyrun Industrial Co., Ltd.

Company type: Leading producer
Skyrun Industrial Co.Limited, established in 2003, a state-controlled company (By Skyrun Corp. Additionally 4-(2-Thiazolylsulfamoyl)-succinanilic acid is supplied by us. & High Hope) in China, specializing in developing, producing and handing raw pharmaceutical material and intermediates. We have expanded a compositive entity from initially only as a small manufacturer. Skyrun Industrial Co., Ltd. is supplier for Sermorelin. We have extensive knowledge of domestic and international pharmaceutical markets. Our working range can be start from small amount in research stage to big bulk for industrial produc ...
Country: P.R.China   Phone: +86-576-84015261   Telefax: +86-576-84015261

Xingrui Industry Co., Limited

Company type: Leading producer
Xingrui Industry CO., LTD. is a professional manufacturing enterprise integrating R&D, production and sales. is also served by Xingrui Industry Co., Limited. The products involved fine chemicals, pharmaceutical intermediates, dye intermediates, cosmetic raw materials and so on. The company is ranked among the outstanding producers in the fine chemical industry. Xingrui Industry Co., Limited is supplier for Sermorelin. Xingrui Industry always strive to be the most reliable partner of our customers, and strive to build a customer-trusted, socially respected, world-class fi ...
Country: P.R.China   Phone: +86-531-88980365   Telefax: +86-531-88980365

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is supplier for Sermorelin. BuGuCh & Partners is a seller of Silver iodate. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Leap Chem Co., Ltd

Company type: Bulk and laboratory supplier
LEAPChem, a specialized fine chemicals supplier for research, development and production. Leap Chem Co., Ltd is supplier for Sermorelin. LEAPChem provides nearly 50,000 rare and innovative chemical products to support the evolving needs of our customers in research & bulk manufacturing activities. We are supplier of bis-(4-Biphenylyl)amine. As a highly customer-oriented enterprise, we are committed to providing high-quality customer services and products to our global customers in a cost-effective and efficient manner. Our client list includes many m ...
Country: P.R.China   Phone: +852-30606658   Telefax:

Safety Information

WGK Germany:
3
Storage tempuraturx:
-20°C

Most viewed

Within the past time user are also interested in the following chemicals.
Acacia Seyal

Suppliers and manufactures - with identical CAS number as Sermorelin

For the following products supplier are listed below:
    GRF (1-29) amide (human)
    Sermorelin acetate


The following companies are not suppliers of Sermorelin . This companies are suppliers for equal products with the same CAS number. CAS: 86168-78-7


Supplier of

GRF (1-29) amide (human)

(CAS: 86168-78-7)

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. BuGuCh & Partners is a seller of Silver iodate. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Bachem AG

Company type: Leading producer
About Bachem Bachem is a listed technology-based company focused on peptide chemistry. We are seller of Fmoc-Ser(tBu)-Ser(Psi(Me,Me)pro)-OH. The company provides a full range of services to the pharma and biotech industries. It specializes in the development of innovative, efficient manufacturing processes and the reliable production of peptide-based active pharmaceutical ingredients. A comprehensive catalog of biochemicals and exclusive custom syntheses for research labs complete the service portfolio. Headquartered in Swi ...
Country: Switzerland   Phone: +41 58 595 2021   Telefax: +41 58 595 2040

Supplier of

Sermorelin acetate

(CAS: 86168-78-7)

BuGuCh & Partners

Company type: Analytical Institution
We, BuGuCh & Partners, are an international acting and innovative company, leading in developing and manufacturing. We operates major facilities in North America, Europe and the Pacific Rim, as well as facilities in China, Japan and Saudi Arabia operated through joint ventures. We maintain independently or are partners of some production sites in Europe, Asia and South America. We sell Silver iodate as well. Our global network is a strength. Our products range from natural gas, oil and basic chemi ...
Country: Germany   Phone:   Telefax:

Chemos GmbH & Co. KG

Company type: Supplier of chemical products
Chemos is a leading supplier of chemical specialties for your research and production needs. Additionally Fmoc-3-Iodo-D-tyrosine is supplied by us. Everything new starts small and needs specific support during scale up and production. With over 25 years of experience in the fine chemical market Chemos is supporting research institutions and chemical companies in Europe and America. Chemos is a sourcing and distribution company with a grown and strong network of custom manufacturing companies and chemical producers from around the ...
Country: Germany   Phone: +49-871-966346-0   Telefax: +49-871-966346-13

Wilshire Technologies, Inc.

Company type: Bulk chemical producer
WILSHIRE TECHNOLOGIES, Inc., is a leader in innovative process chemistry and development, producing value-added reactants, reagents and intermediates at significant cost-savings to our customers. We offer the chemical community a broad range of organic chemicals -- each backed by extensive technical information and service support - as well as custom syntheses -- kilogram to tons -- tailored to our clients' specific needs. Wilshire Technologies, Inc. also offers 2-Bromo-9-phenyl-9H-fluoren-9-ol.
Country: USA   Phone: +1-609-683-1017   Telefax: +1-732-274-0149

Simagchem Corporation

Company type: Bulk chemical producer
Your partner in China for chemicals business. Aqueous cationic polymer (IME) is also served by Simagchem Corporation. Expertize in supplies and sources of fine, specialty, pharmaceutical chemicals and intermediates. WE offer high quality products and JIT services with instant market intelligence in China, custom synthesis in our 3 production sites, famous principals as Brenntag, Univar,S inopec, Grace, Petrobras, DKSH, Formitex, Evonik, Merck, TCI, Sanofi, Chemo with creditable reputation and business cooperation.
Country: P.R.China   Phone: +86 592 2680 277   Telefax: +86 592 2680 237

Xiamen Equation Chemical Co.,Ltd

Company type: Bulk chemical producer
Welcome to Equation chemical, your reliable partner in China as an important supplier of bulk specialty chemicals for industry & life science. We are committed to provide experienced high quality product and JIT performance to benefit our customers. We are seller of Flavoxate hydrochloride.
Country: P.R.China   Phone: +86 592 6515854   Telefax: +86 592 6515854

Shandong Minglang Chemical Co., Ltd.

Company type: Analytical Institution
Minglang Chemical is owned by Minglang Group,is a large manufacturer of fine chemicals and cosmetic materials that integrates R&D,production and sales together.It is located in the east of the Nanwang Economic Development District in Linzi,and the west of it is Qilu Petroleum Chemical Group,the east of it is Zijiang Road and the transportation is convenient.The enterprise covers an area of 9,000 square meters and the building area can be 3,200 square meters. Additionally is supplied by us. In recent years,t ...
Country: P.R.China   Phone: +86-13220566916   Telefax: +86 531 58990167

polypeptide.ltd

Company type: Laboratory supplier
Xuchang Shangke Chemical Co., Ltd. (Phcoker / Polypeptide.ltd) was founded in 2008, located in the Fine Chemical Industrial Park of Zhangpan Town, Xuchang, Henan Province, with 10 million square meters, total assets of 10 million US dollars, and more than 100 employees. Shangke Chemical is a high-tech enterprise specializing in active pharmaceutical intermediates (APIs). Additionally Degarelix acetate is supplied by us. To control the quality during production, a large number of experienced professionals, a first-class pr ...
Country: P.R.China   Phone: +86 152 1950 7320   Telefax:

Wuhan PharmChem Co., LTD.

Company type: Import & export company
Wuhan PharmChem CO., LTD. We provide as well. has been a premier chemical supplier distributing high-quality chemicals to businesses in various industries for the whole world. At Wuhan PharmChem, we are committed to excellence.From manufacturing to packaging and delivery, we provide quality, reliability and the highest degree of customer service.Our scope of service is organized/structured around the unique needs of each client.Our mission is establish long-term relationships with our clien ...
Country: P.R.China   Phone: +86 27 85835203   Telefax: +86 27 85835203


Related products:


Language:
english português français deutsch español
svensk norsk italiano 中国 日本語 по-русски




How do you find
new customers?

click here


Suzhou Bichal Biologica
SUZHOU BICHAL BIOLOGICAL TECHNOLOGY CO., LTD is a fast-growing pharmaceutical company that engages


Sino Life Industry Limi
Lifechemical was found in 1997,As be trustworthy and reliable supplier of chemicals, we specialized


Stereokem
Stereokem is a chemistry-savvy, innovation driven company engaged in development, production and ma


Chemtour Biotech Co., L
Founded in 2014, Chemtour is specializing in providing pharmaceutical raw materials and chemicals f


Autech Industry Co.,Lim
Autech Industry Co., Ltd was established in 2006, the head office is in Jinan City, Shandong Provin


Laizhou Jinxing Chemica
LAIZHOU JINXING CHEMICAL CO., LTD. is the largest manufacturer of Sulfamic Acid in north China. 


© Copyright 1996 to 2024 by Netvertise GmbH. All rights reserved Sermorelin